PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011071694.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 365aa    MW: 41958.6 Da    PI: 6.5091
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011071694.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.36.3e-211861245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    r e+ s rqvt+ kRr+gilKKA+E+SvLCd+++ +++fs+tgk
  XP_011071694.1 18 RLESLSSRQVTYGKRRAGILKKAQEISVLCDIDIILLMFSPTGK 61
                    678999************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.9E-28968IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.619969IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-2410103IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-171131IPR002100Transcription factor, MADS-box
PfamPF003191.3E-172063IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-173146IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-174667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MSFDCICRMG RVKLKIQRLE SLSSRQVTYG KRRAGILKKA QEISVLCDID IILLMFSPTG  60
KPSIFRGQRS NLDEMIAKYA QLTPKERAKR RLESLETLKR NFKKLDQDVD IEEFLDTSTP  120
STEEMHSRVN MMQAQLSEVR KRLSWWTNPD KIEDIEHLNQ MENSLRESLN RTHMHKQEKF  180
LKDPLISFDC TSQFQNGMHL PIVTTSDQDC QTQSWLPGGE SQHMILPNEP HFLASRDIDC  240
SRDASFPTCS GYFGDMKEQD LDNPRQMKNE RQGGISVEDY ACSAPLRLPL VEQYPYHSFA  300
NLSFPDLLEP GRETNFQPST MDYQITGNFE LPRSVYNSLP HSLVPTVGSC VISMLNGHSY  360
PQPPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-149100190Myocyte-specific enhancer factor 2B
1tqe_R4e-149100190Myocyte-specific enhancer factor 2B
1tqe_Q4e-149100190Myocyte-specific enhancer factor 2B
1tqe_P4e-149100190Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071694.10.0PREDICTED: agamous-like MADS-box protein AGL21 isoform X1
RefseqXP_011071695.10.0PREDICTED: agamous-like MADS-box protein AGL21 isoform X1
SwissprotQ7X9I07e-81AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A022R5G80.0A0A022R5G8_ERYGU; Uncharacterized protein
STRINGVIT_17s0000g06340.t011e-139(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA76402124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.14e-82AGAMOUS-like 65